General aviation · Tampa, United States

Peter O Knight

KTPFTPF
Elevation
8 ft
Coordinates
27°55′N 82°27′W
Local time
--:-- America/New York

Photo: U.S. Department of Defense · Public domain · Wikimedia Commons

Field information

KTPF at a glance

Reference data compiled from public aeronautical sources. Our OCC confirms the operational details for your flight before dispatch.

  • Classification

    General aviation

  • Time zone

    America/New York

    America/New York

  • Country

    United States

    US

  • Municipality

    Tampa

  • Elevation

    8 ft

  • Position

    27.9156, -82.4493

Flight support

Flight support at KTPF.

The Network Plan coordinates flight support at Peter O Knight (KTPF / TPF) in Tampa, United States of America, through one 24/7 OCC desk. KTPF is listed in our network as a general aviation. Before dispatch, our OCC verifies permit lead times, slot availability, and local handler capabilities.

Services coordinated at KTPF

  1. 01

    Overflight & Landing Permits – United States of America

    Efficient coordination of overflight, landing, ad hoc, and seasonal block permit applications with the civil aviation authority of United States of America. Applicable permit lead times for United States of America are confirmed by the duty dispatcher at the time of request. For airline operators, navigation fee verifications, overflight charge audits, and CAA account reconciliations for United States of America are managed end-to-end.

  2. 02

    Ground Handling at KTPF

    Direct FBO and handler coordination at KTPF covering ramp parking, towing, GPU/ACU support, CIQ formalities, and real-time operational updates.

  3. 03

    Fuel Arrangements at KTPF

    Competitive into-plane pricing, secure fuel releases, and credit arrangements through major oil suppliers and local distributors worldwide. Availability at KTPF is confirmed by the duty dispatcher at the time of request.

  4. 04

    Flight Planning & Dispatch to KTPF

    Optimized routing, weather analysis, NOTAM review, fuel planning, and flight plan filing supported by continuous 24/7 OCC monitoring. Planning reference for KTPF: 27° 54′ 56″ N 82° 26′ 57″ W; elevation 8 ft.

  5. 05

    Crew & Passenger Services in Tampa

    Ground transportation, hotel reservations, visa assistance, and expedited meet & greet for crews operating into Tampa. Complete passenger handling coordination covering check-in, boarding, special assistance, and CIQ formalities at KTPF.

  6. 06

    Cargo Operations at KTPF

    Support for freighter operations into KTPF covering ULD logistics, ramp and slot coordination, dangerous goods coordination, and rapid turnarounds.

Location

Where KTPF sits in the network

Open in map

Nearest airports in our network

NESWKMCFKTPAKVDFKPIEKSPGKCLWKTPF

Operating into KTPF?

Our 24/7 OCC arranges permits, ground handling, fuel and crew support at Peter O Knight — one desk for the whole trip.

Request flight supportExplore our services