General aviation · Losuia, Papua New Guinea

Losuia

AYKALSA
Elevation
27 ft
Coordinates
8°30′S 151°05′E
Local time
Pacific/Port Moresby

Photo: U.S. Department of Defense · Public domain · Wikimedia Commons

Field information

AYKA runways, fuel & airport data

Reference data compiled from public aeronautical sources. Our OCC confirms the operational details for your flight before dispatch.

Losuia (AYKA/LSA) has one runway, 14/32, 5,348 ft (1,630 m) long. Our OCC arranges ground handling, landing permits and fuel at AYKA, and confirms every figure on this page with the airport and handler before dispatch.

  • Classification

    General aviation

  • Time zone

    Pacific/Port Moresby

  • Country

    Papua New Guinea

    PG

  • Municipality

    Losuia

  • Elevation

    27 ft

  • Position

    -8.5058, 151.0810

Runways · AYKA

RunwayLengthWidthSurfaceLighting
14/325,348 ft (1,630 m)———

Flight support

Ground handling, permits & fuel at AYKA.

The Network Plan coordinates flight support at Losuia (AYKA / LSA) in Losuia, Papua New Guinea, through one 24/7 OCC desk. AYKA is listed in our network as a general aviation. Before dispatch, our OCC verifies permit lead times, slot availability, and local handler capabilities.

Services coordinated at AYKA

  1. 01

    Overflight & Landing Permits – Papua New Guinea

    Efficient coordination of overflight, landing, ad hoc, and seasonal block permit applications with the civil aviation authority of Papua New Guinea. Applicable permit lead times for Papua New Guinea are confirmed by the duty dispatcher at the time of request. For airline operators, navigation fee verifications, overflight charge audits, and CAA account reconciliations for Papua New Guinea are managed end-to-end.

  2. 02

    Ground Handling at AYKA

    Direct FBO and handler coordination at AYKA covering ramp parking, towing, GPU/ACU support, CIQ formalities, and real-time operational updates.

  3. 03

    Fuel Arrangements at AYKA

    Competitive into-plane pricing, secure fuel releases, and credit arrangements through major oil suppliers and local distributors worldwide. Availability at AYKA is confirmed by the duty dispatcher at the time of request.

  4. 04

    Flight Planning & Dispatch to AYKA

    Optimized routing, weather analysis, NOTAM review, fuel planning, and flight plan filing supported by continuous 24/7 OCC monitoring. Planning reference for AYKA: 8° 30′ 21″ S 151° 4′ 52″ E; elevation 27 ft.

  5. 05

    Crew & Passenger Services in Losuia

    Ground transportation, hotel reservations, visa assistance, and expedited meet & greet for crews operating into Losuia. Complete passenger handling coordination covering check-in, boarding, special assistance, and CIQ formalities at AYKA.

  6. 06

    Cargo Operations at AYKA

    Support for freighter operations into AYKA covering ULD logistics, ramp and slot coordination, dangerous goods coordination, and rapid turnarounds.

Location

Where AYKA sits in the network

Open in map

Nearest airports in our network

NESWAYGNAYGRAYMSAYHKAYPYAYTKAYKA

Operating into AYKA?

Our 24/7 OCC arranges permits, ground handling, fuel and crew support at Losuia — one desk for the whole trip.

Request flight supportExplore our services