General aviation · Ilaka, Madagascar

Atsinanana

FMMQILK
Elevation
33 ft
Coordinates
19°35′S 48°48′E
Local time
Indian/Antananarivo

Photo: U.S. Department of Defense · Public domain · Wikimedia Commons

Field information

FMMQ runways, fuel & airport data

Reference data compiled from public aeronautical sources. Our OCC confirms the operational details for your flight before dispatch.

  • Classification

    General aviation

  • Time zone

    Indian/Antananarivo

  • Country

    Madagascar

    MG

  • Municipality

    Ilaka

  • Elevation

    33 ft

  • Position

    -19.5830, 48.8030

Flight support

Ground handling, permits & fuel at FMMQ.

The Network Plan coordinates flight support at Atsinanana (FMMQ / ILK) in Ilaka, Madagascar, through one 24/7 OCC desk. FMMQ is listed in our network as a general aviation. Before dispatch, our OCC verifies permit lead times, slot availability, and local handler capabilities.

Services coordinated at FMMQ

  1. 01

    Overflight & Landing Permits – Madagascar

    Efficient coordination of overflight, landing, ad hoc, and seasonal block permit applications with the civil aviation authority of Madagascar. Applicable permit lead times for Madagascar are confirmed by the duty dispatcher at the time of request. For airline operators, navigation fee verifications, overflight charge audits, and CAA account reconciliations for Madagascar are managed end-to-end.

  2. 02

    Ground Handling at FMMQ

    Direct FBO and handler coordination at FMMQ covering ramp parking, towing, GPU/ACU support, CIQ formalities, and real-time operational updates.

  3. 03

    Fuel Arrangements at FMMQ

    Competitive into-plane pricing, secure fuel releases, and credit arrangements through major oil suppliers and local distributors worldwide. Availability at FMMQ is confirmed by the duty dispatcher at the time of request.

  4. 04

    Flight Planning & Dispatch to FMMQ

    Optimized routing, weather analysis, NOTAM review, fuel planning, and flight plan filing supported by continuous 24/7 OCC monitoring. Planning reference for FMMQ: 19° 34′ 59″ S 48° 48′ 11″ E; elevation 33 ft.

  5. 05

    Crew & Passenger Services in Ilaka

    Ground transportation, hotel reservations, visa assistance, and expedited meet & greet for crews operating into Ilaka. Complete passenger handling coordination covering check-in, boarding, special assistance, and CIQ formalities at FMMQ.

  6. 06

    Cargo Operations at FMMQ

    Support for freighter operations into FMMQ covering ULD logistics, ramp and slot coordination, dangerous goods coordination, and rapid turnarounds.

Location

Where FMMQ sits in the network

Open in map

Nearest airports in our network

NESWFMMYFMMHFMFEFMMIFMMTFMMAFMMQ

Operating into FMMQ?

Our 24/7 OCC arranges permits, ground handling, fuel and crew support at Atsinanana — one desk for the whole trip.

Request flight supportExplore our services