General aviation · Monkey Bay, Malawi

Monkey Bay Airport

FWMY604
Elevation
1,580 ft
Coordinates
14°05′S 34°55′E
Local time
Africa/Blantyre

Photo: U.S. Department of Defense · Public domain · Wikimedia Commons

Field information

FWMY runways, fuel & airport data

Reference data compiled from public aeronautical sources. Our OCC confirms the operational details for your flight before dispatch.

  • Classification

    General aviation

  • Time zone

    Africa/Blantyre

  • Country

    Malawi

    MW

  • Municipality

    Monkey Bay

  • Elevation

    1,580 ft

  • Position

    -14.0836, 34.9197

Flight support

Ground handling, permits & fuel at FWMY.

The Network Plan coordinates flight support at Monkey Bay Airport (FWMY / 604) in Monkey Bay, Malawi, through one 24/7 OCC desk. FWMY is listed in our network as a general aviation. Before dispatch, our OCC verifies permit lead times, slot availability, and local handler capabilities.

Services coordinated at FWMY

  1. 01

    Overflight & Landing Permits – Malawi

    Efficient coordination of overflight, landing, ad hoc, and seasonal block permit applications with the civil aviation authority of Malawi. Applicable permit lead times for Malawi are confirmed by the duty dispatcher at the time of request. For airline operators, navigation fee verifications, overflight charge audits, and CAA account reconciliations for Malawi are managed end-to-end.

  2. 02

    Ground Handling at FWMY

    Direct FBO and handler coordination at FWMY covering ramp parking, towing, GPU/ACU support, CIQ formalities, and real-time operational updates.

  3. 03

    Fuel Arrangements at FWMY

    Competitive into-plane pricing, secure fuel releases, and credit arrangements through major oil suppliers and local distributors worldwide. Availability at FWMY is confirmed by the duty dispatcher at the time of request.

  4. 04

    Flight Planning & Dispatch to FWMY

    Optimized routing, weather analysis, NOTAM review, fuel planning, and flight plan filing supported by continuous 24/7 OCC monitoring. Planning reference for FWMY: 14° 5′ 1″ S 34° 55′ 11″ E; elevation 1580 ft.

  5. 05

    Crew & Passenger Services in Monkey Bay

    Ground transportation, hotel reservations, visa assistance, and expedited meet & greet for crews operating into Monkey Bay. Complete passenger handling coordination covering check-in, boarding, special assistance, and CIQ formalities at FWMY.

  6. 06

    Cargo Operations at FWMY

    Support for freighter operations into FWMY covering ULD logistics, ramp and slot coordination, dangerous goods coordination, and rapid turnarounds.

Location

Where FWMY sits in the network

Open in map

Nearest airports in our network

NESWFWCMFWSMFQLCFWKIFWCLFQTTFWMY

Operating into FWMY?

Our 24/7 OCC arranges permits, ground handling, fuel and crew support at Monkey Bay Airport — one desk for the whole trip.

Request flight supportExplore our services