Regional airport · Saltillo, Mexico

Saltillo/Plan de Guadalupe Intl

MMIOSLW
Elevation
4,778 ft
Coordinates
25°32′N 100°56′W
Local time
America/Monterrey

Photo: U.S. Department of Defense · Public domain · Wikimedia Commons

Field information

MMIO runways, fuel & airport data

Reference data compiled from public aeronautical sources. Our OCC confirms the operational details for your flight before dispatch.

Saltillo/Plan de Guadalupe Intl (MMIO/SLW) has one runway, 17/35, 9,506 ft (2,897 m) long of asphalt. Fuel on the field: Jet A-1 & Avgas. Rescue and fire-fighting cover is published as RFFS category 5. Operating hours: 1300-0300Z. Our OCC arranges ground handling, landing permits and fuel at MMIO, and confirms every figure on this page with the airport and handler before dispatch.

  • Classification

    Regional airport

  • Time zone

    America/Monterrey

  • Country

    Mexico

    MX

  • Municipality

    Saltillo

  • Elevation

    4,778 ft

  • Position

    25.5379, -100.9283

  • Traffic level

    High

  • Fuel

    Jet A-1 & Avgas

  • Fire & rescue

    RFFS category 5

  • Operating hours

    1300-0300Z

Runways · MMIO

RunwayLengthWidthSurfaceLighting
17/359,506 ft (2,897 m)148 ftasphaltLighted

Flight support

Ground handling, permits & fuel at MMIO.

The Network Plan coordinates flight support at Saltillo/Plan de Guadalupe Intl (MMIO / SLW) in Saltillo, Mexico, through one 24/7 OCC desk. MMIO is listed in our network as a regional airport. Before dispatch, our OCC verifies permit lead times, slot availability, and local handler capabilities.

Services coordinated at MMIO

  1. 01

    Overflight & Landing Permits – Mexico

    Efficient coordination of overflight, landing, ad hoc, and seasonal block permit applications with the civil aviation authority of Mexico. Applicable permit lead times for Mexico are confirmed by the duty dispatcher at the time of request. For airline operators, navigation fee verifications, overflight charge audits, and CAA account reconciliations for Mexico are managed end-to-end.

  2. 02

    Ground Handling at MMIO

    Direct FBO and handler coordination at MMIO covering ramp parking, towing, GPU/ACU support, CIQ formalities, and real-time operational updates.

  3. 03

    Fuel Arrangements at MMIO

    Competitive into-plane pricing, secure fuel releases, and credit arrangements through major oil suppliers and local distributors worldwide. Availability at MMIO is confirmed by the duty dispatcher at the time of request.

  4. 04

    Flight Planning & Dispatch to MMIO

    Optimized routing, weather analysis, NOTAM review, fuel planning, and flight plan filing supported by continuous 24/7 OCC monitoring. Planning reference for MMIO: 25° 32′ 16″ N 100° 55′ 42″ W; elevation 4778 ft.

  5. 05

    Crew & Passenger Services in Saltillo

    Ground transportation, hotel reservations, visa assistance, and expedited meet & greet for crews operating into Saltillo. Complete passenger handling coordination covering check-in, boarding, special assistance, and CIQ formalities at MMIO.

  6. 06

    Cargo Operations at MMIO

    Support for freighter operations into MMIO covering ULD logistics, ramp and slot coordination, dangerous goods coordination, and rapid turnarounds.

Location

Where MMIO sits in the network

Open in mapRead on Wikipedia

Nearest airports in our network

NESWMMANMMMYMMMVMMTCMMNLKLRDMMIO

Operating into MMIO?

Our 24/7 OCC arranges permits, ground handling, fuel and crew support at Saltillo/Plan de Guadalupe Intl — one desk for the whole trip.

Request flight supportExplore our services