General aviation · Tabuaeran, Kiribati

Tabuaeran

PLFATNV
Coordinates
3°54′N 159°23′W
Local time
Pacific/Kiritimati

Photo: U.S. Department of Defense · Public domain · Wikimedia Commons

Field information

PLFA runways, fuel & airport data

Reference data compiled from public aeronautical sources. Our OCC confirms the operational details for your flight before dispatch.

  • Classification

    General aviation

  • Time zone

    Pacific/Kiritimati

  • Country

    Kiribati

    KI

  • Municipality

    Tabuaeran Island

  • Position

    3.8994, -159.3890

Flight support

Ground handling, permits & fuel at PLFA.

The Network Plan coordinates flight support at Tabuaeran (PLFA / TNV) in Tabuaeran, Kiribati, through one 24/7 OCC desk. PLFA is listed in our network as a general aviation. Before dispatch, our OCC verifies permit lead times, slot availability, and local handler capabilities.

Services coordinated at PLFA

  1. 01

    Overflight & Landing Permits – Kiribati

    Efficient coordination of overflight, landing, ad hoc, and seasonal block permit applications with the civil aviation authority of Kiribati. Applicable permit lead times for Kiribati are confirmed by the duty dispatcher at the time of request. For airline operators, navigation fee verifications, overflight charge audits, and CAA account reconciliations for Kiribati are managed end-to-end.

  2. 02

    Ground Handling at PLFA

    Direct FBO and handler coordination at PLFA covering ramp parking, towing, GPU/ACU support, CIQ formalities, and real-time operational updates.

  3. 03

    Fuel Arrangements at PLFA

    Competitive into-plane pricing, secure fuel releases, and credit arrangements through major oil suppliers and local distributors worldwide. Availability at PLFA is confirmed by the duty dispatcher at the time of request.

  4. 04

    Flight Planning & Dispatch to PLFA

    Optimized routing, weather analysis, NOTAM review, fuel planning, and flight plan filing supported by continuous 24/7 OCC monitoring. Planning reference for PLFA: 3° 53′ 58″ N 159° 23′ 20″ W.

  5. 05

    Crew & Passenger Services in Tabuaeran

    Ground transportation, hotel reservations, visa assistance, and expedited meet & greet for crews operating into Tabuaeran. Complete passenger handling coordination covering check-in, boarding, special assistance, and CIQ formalities at PLFA.

  6. 06

    Cargo Operations at PLFA

    Support for freighter operations into PLFA covering ULD logistics, ramp and slot coordination, dangerous goods coordination, and rapid turnarounds.

Location

Where PLFA sits in the network

Open in map

Nearest airports in our network

NESWPLCHPLPANCPYPCISNCMHNCPKPLFA

Operating into PLFA?

Our 24/7 OCC arranges permits, ground handling, fuel and crew support at Tabuaeran — one desk for the whole trip.

Request flight supportExplore our services