General aviation · Iligan City, Philippines

Iligan City/Maria Cristina Iligan

RPMIIGN
Elevation
1,300 ft
Coordinates
8°08′N 124°13′E
Local time
Asia/Manila

Photo: U.S. Department of Defense · Public domain · Wikimedia Commons

Field information

RPMI runways, fuel & airport data

Reference data compiled from public aeronautical sources. Our OCC confirms the operational details for your flight before dispatch.

Iligan City/Maria Cristina Iligan (RPMI/IGN) has one runway, 02/20, 4,593 ft (1,400 m) long of concrete. Our OCC arranges ground handling, landing permits and fuel at RPMI, and confirms every figure on this page with the airport and handler before dispatch.

  • Classification

    General aviation

  • Time zone

    Asia/Manila

  • Country

    Philippines

    PH

  • Municipality

    Balo-i

  • Elevation

    1,300 ft

  • Position

    8.1305, 124.2150

Runways · RPMI

RunwayLengthWidthSurfaceLighting
02/204,593 ft (1,400 m)60 ftconcrete—

Flight support

Ground handling, permits & fuel at RPMI.

The Network Plan coordinates flight support at Iligan City/Maria Cristina Iligan (RPMI / IGN) in Iligan City, Philippines, through one 24/7 OCC desk. RPMI is listed in our network as a general aviation. Before dispatch, our OCC verifies permit lead times, slot availability, and local handler capabilities.

Services coordinated at RPMI

  1. 01

    Overflight & Landing Permits – Philippines

    Efficient coordination of overflight, landing, ad hoc, and seasonal block permit applications with the civil aviation authority of Philippines. Applicable permit lead times for Philippines are confirmed by the duty dispatcher at the time of request. For airline operators, navigation fee verifications, overflight charge audits, and CAA account reconciliations for Philippines are managed end-to-end.

  2. 02

    Ground Handling at RPMI

    Direct FBO and handler coordination at RPMI covering ramp parking, towing, GPU/ACU support, CIQ formalities, and real-time operational updates.

  3. 03

    Fuel Arrangements at RPMI

    Competitive into-plane pricing, secure fuel releases, and credit arrangements through major oil suppliers and local distributors worldwide. Availability at RPMI is confirmed by the duty dispatcher at the time of request.

  4. 04

    Flight Planning & Dispatch to RPMI

    Optimized routing, weather analysis, NOTAM review, fuel planning, and flight plan filing supported by continuous 24/7 OCC monitoring. Planning reference for RPMI: 8° 7′ 50″ N 124° 12′ 54″ E; elevation 1300 ft.

  5. 05

    Crew & Passenger Services in Iligan City

    Ground transportation, hotel reservations, visa assistance, and expedited meet & greet for crews operating into Iligan City. Complete passenger handling coordination covering check-in, boarding, special assistance, and CIQ formalities at RPMI.

  6. 06

    Cargo Operations at RPMI

    Support for freighter operations into RPMI covering ULD logistics, ramp and slot coordination, dangerous goods coordination, and rapid turnarounds.

Location

Where RPMI sits in the network

Open in map

Nearest airports in our network

NESWRPMYRPVDRPSPRPMDRPMSRPVMRPMI

Operating into RPMI?

Our 24/7 OCC arranges permits, ground handling, fuel and crew support at Iligan City/Maria Cristina Iligan — one desk for the whole trip.

Request flight supportExplore our services