Regional airport · Tandag, Philippines

Tandag

RPMWTDG
Elevation
16 ft
Coordinates
9°04′N 126°10′E
Local time
Asia/Manila

Photo: U.S. Department of Defense · Public domain · Wikimedia Commons

Field information

RPMW runways, fuel & airport data

Reference data compiled from public aeronautical sources. Our OCC confirms the operational details for your flight before dispatch.

Tandag (RPMW/TDG) has one runway, 03/21, 4,765 ft (1,452 m) long of concrete. Fuel on the field: No fuel available. Rescue and fire-fighting cover is published as RFFS category 4. Our OCC arranges ground handling, landing permits and fuel at RPMW, and confirms every figure on this page with the airport and handler before dispatch.

  • Classification

    Regional airport

  • Time zone

    Asia/Manila

  • Country

    Philippines

    PH

  • Municipality

    Tandag

  • Elevation

    16 ft

  • Position

    9.0720, 126.1713

  • Fuel

    No fuel available

  • Fire & rescue

    RFFS category 4

Runways · RPMW

RunwayLengthWidthSurfaceLighting
03/214,765 ft (1,452 m)98 ftconcrete—

Flight support

Ground handling, permits & fuel at RPMW.

The Network Plan coordinates flight support at Tandag (RPMW / TDG) in Tandag, Philippines, through one 24/7 OCC desk. RPMW is listed in our network as a regional airport. Before dispatch, our OCC verifies permit lead times, slot availability, and local handler capabilities.

Services coordinated at RPMW

  1. 01

    Overflight & Landing Permits – Philippines

    Efficient coordination of overflight, landing, ad hoc, and seasonal block permit applications with the civil aviation authority of Philippines. Applicable permit lead times for Philippines are confirmed by the duty dispatcher at the time of request. For airline operators, navigation fee verifications, overflight charge audits, and CAA account reconciliations for Philippines are managed end-to-end.

  2. 02

    Ground Handling at RPMW

    Direct FBO and handler coordination at RPMW covering ramp parking, towing, GPU/ACU support, CIQ formalities, and real-time operational updates.

  3. 03

    Fuel Arrangements at RPMW

    Competitive into-plane pricing, secure fuel releases, and credit arrangements through major oil suppliers and local distributors worldwide. Availability at RPMW is confirmed by the duty dispatcher at the time of request.

  4. 04

    Flight Planning & Dispatch to RPMW

    Optimized routing, weather analysis, NOTAM review, fuel planning, and flight plan filing supported by continuous 24/7 OCC monitoring. Planning reference for RPMW: 9° 4′ 19″ N 126° 10′ 17″ E; elevation 16 ft.

  5. 05

    Crew & Passenger Services in Tandag

    Ground transportation, hotel reservations, visa assistance, and expedited meet & greet for crews operating into Tandag. Complete passenger handling coordination covering check-in, boarding, special assistance, and CIQ formalities at RPMW.

  6. 06

    Cargo Operations at RPMW

    Support for freighter operations into RPMW covering ULD logistics, ramp and slot coordination, dangerous goods coordination, and rapid turnarounds.

Location

Where RPMW sits in the network

Open in mapRead on Wikipedia

Nearest airports in our network

NESWRPMSRPMYRPMDRPSPRPVARPVMRPMW

Operating into RPMW?

Our 24/7 OCC arranges permits, ground handling, fuel and crew support at Tandag — one desk for the whole trip.

Request flight supportExplore our services