International hub · Quito, Ecuador

New Quito International Mariscal Sucre

SEQMUIO
Elevation
7,841 ft
Coordinates
0°08′S 78°21′W
Local time
America/Guayaquil

Photo: U.S. Department of Defense · Public domain · Wikimedia Commons

Field information

SEQM runways, fuel & airport data

Reference data compiled from public aeronautical sources. Our OCC confirms the operational details for your flight before dispatch.

New Quito International Mariscal Sucre (SEQM/UIO) has one runway, 18/36, 13,445 ft (4,098 m) long of concrete. Fuel on the field: Jet A-1. Rescue and fire-fighting cover is published as RFFS category 9. Our OCC arranges ground handling, landing permits and fuel at SEQM, and confirms every figure on this page with the airport and handler before dispatch.

  • Classification

    International hub

  • Time zone

    America/Guayaquil

  • Country

    Ecuador

    EC

  • Municipality

    Quito

  • Elevation

    7,841 ft

  • Position

    -0.1254, -78.3543

  • Traffic level

    High

  • Fuel

    Jet A-1

  • Fire & rescue

    RFFS category 9

  • Airport category

    C

    Special crew qualification required

Runways · SEQM

RunwayLengthWidthSurfaceLighting
18/3613,445 ft (4,098 m)148 ftconcreteLighted

Flight support

Ground handling, permits & fuel at SEQM.

The Network Plan coordinates flight support at New Quito International Mariscal Sucre (SEQM / UIO) in Quito, Ecuador, through one 24/7 OCC desk. SEQM is listed in our network as an international hub. Before dispatch, our OCC verifies permit lead times, slot availability, and local handler capabilities.

Services coordinated at SEQM

  1. 01

    Overflight & Landing Permits – Ecuador

    Efficient coordination of overflight, landing, ad hoc, and seasonal block permit applications with the civil aviation authority of Ecuador. Applicable permit lead times for Ecuador are confirmed by the duty dispatcher at the time of request. For airline operators, navigation fee verifications, overflight charge audits, and CAA account reconciliations for Ecuador are managed end-to-end.

  2. 02

    Ground Handling at SEQM

    Direct FBO and handler coordination at SEQM covering ramp parking, towing, GPU/ACU support, CIQ formalities, and real-time operational updates.

  3. 03

    Fuel Arrangements at SEQM

    Competitive into-plane pricing, secure fuel releases, and credit arrangements through major oil suppliers and local distributors worldwide. Availability at SEQM is confirmed by the duty dispatcher at the time of request.

  4. 04

    Flight Planning & Dispatch to SEQM

    Optimized routing, weather analysis, NOTAM review, fuel planning, and flight plan filing supported by continuous 24/7 OCC monitoring. Planning reference for SEQM: 0° 7′ 31″ S 78° 21′ 16″ W; elevation 7841 ft.

  5. 05

    Crew & Passenger Services in Quito

    Ground transportation, hotel reservations, visa assistance, and expedited meet & greet for crews operating into Quito. Complete passenger handling coordination covering check-in, boarding, special assistance, and CIQ formalities at SEQM.

  6. 06

    Cargo Operations at SEQM

    Support for freighter operations into SEQM covering ULD logistics, ramp and slot coordination, dangerous goods coordination, and rapid turnarounds.

Location

Where SEQM sits in the network

Open in mapRead on Wikipedia

Nearest airports in our network

NESWSELTSEAMSKIPSESMSENLSETNSEQM

Operating into SEQM?

Our 24/7 OCC arranges permits, ground handling, fuel and crew support at New Quito International Mariscal Sucre — one desk for the whole trip.

Request flight supportExplore our services