General aviation · Kamalpur, India

Kamalpur

VEKMIXQ
Elevation
131 ft
Coordinates
24°08′N 91°49′E
Local time
Asia/Kolkata

Photo: U.S. Department of Defense · Public domain · Wikimedia Commons

Field information

VEKM runways, fuel & airport data

Reference data compiled from public aeronautical sources. Our OCC confirms the operational details for your flight before dispatch.

  • Classification

    General aviation

  • Time zone

    Asia/Kolkata

  • Country

    India

    IN

  • Municipality

    Manik Bhandar

  • Elevation

    131 ft

  • Position

    24.1343, 91.8108

Flight support

Ground handling, permits & fuel at VEKM.

The Network Plan coordinates flight support at Kamalpur (VEKM / IXQ) in Kamalpur, India, through one 24/7 OCC desk. VEKM is listed in our network as a general aviation. Before dispatch, our OCC verifies permit lead times, slot availability, and local handler capabilities.

Services coordinated at VEKM

  1. 01

    Overflight & Landing Permits – India

    Efficient coordination of overflight, landing, ad hoc, and seasonal block permit applications with the civil aviation authority of India. Applicable permit lead times for India are confirmed by the duty dispatcher at the time of request. For airline operators, navigation fee verifications, overflight charge audits, and CAA account reconciliations for India are managed end-to-end.

  2. 02

    Ground Handling at VEKM

    Direct FBO and handler coordination at VEKM covering ramp parking, towing, GPU/ACU support, CIQ formalities, and real-time operational updates.

  3. 03

    Fuel Arrangements at VEKM

    Competitive into-plane pricing, secure fuel releases, and credit arrangements through major oil suppliers and local distributors worldwide. Availability at VEKM is confirmed by the duty dispatcher at the time of request.

  4. 04

    Flight Planning & Dispatch to VEKM

    Optimized routing, weather analysis, NOTAM review, fuel planning, and flight plan filing supported by continuous 24/7 OCC monitoring. Planning reference for VEKM: 24° 8′ 4″ N 91° 48′ 39″ E; elevation 131 ft.

  5. 05

    Crew & Passenger Services in Kamalpur

    Ground transportation, hotel reservations, visa assistance, and expedited meet & greet for crews operating into Kamalpur. Complete passenger handling coordination covering check-in, boarding, special assistance, and CIQ formalities at VEKM.

  6. 06

    Cargo Operations at VEKM

    Support for freighter operations into VEKM covering ULD logistics, ramp and slot coordination, dangerous goods coordination, and rapid turnarounds.

Location

Where VEKM sits in the network

Open in map

Nearest airports in our network

NESWVEATVGSYVGHSVGEGVEGTVEIMVEKM

Operating into VEKM?

Our 24/7 OCC arranges permits, ground handling, fuel and crew support at Kamalpur — one desk for the whole trip.

Request flight supportExplore our servicesIndia overflight permit guide