General aviation · Redang, Malaysia

Pulau Redang

WMPRRDN
Elevation
36 ft
Coordinates
5°46′N 103°00′E
Local time
Asia/Kuala Lumpur

Photo: U.S. Department of Defense · Public domain · Wikimedia Commons

Field information

WMPR runways, fuel & airport data

Reference data compiled from public aeronautical sources. Our OCC confirms the operational details for your flight before dispatch.

Rescue and fire-fighting cover is published as RFFS category 4. Our OCC arranges ground handling, landing permits and fuel at WMPR, and confirms every figure on this page with the airport and handler before dispatch.

  • Classification

    General aviation

  • Time zone

    Asia/Kuala Lumpur

  • Country

    Malaysia

    MY

  • Municipality

    Redang

  • Elevation

    36 ft

  • Position

    5.7648, 103.0049

  • Fire & rescue

    RFFS category 4

Flight support

Ground handling, permits & fuel at WMPR.

The Network Plan coordinates flight support at Pulau Redang (WMPR / RDN) in Redang, Malaysia, through one 24/7 OCC desk. WMPR is listed in our network as a general aviation. Before dispatch, our OCC verifies permit lead times, slot availability, and local handler capabilities.

Services coordinated at WMPR

  1. 01

    Overflight & Landing Permits – Malaysia

    Efficient coordination of overflight, landing, ad hoc, and seasonal block permit applications with the civil aviation authority of Malaysia. Applicable permit lead times for Malaysia are confirmed by the duty dispatcher at the time of request. For airline operators, navigation fee verifications, overflight charge audits, and CAA account reconciliations for Malaysia are managed end-to-end.

  2. 02

    Ground Handling at WMPR

    Direct FBO and handler coordination at WMPR covering ramp parking, towing, GPU/ACU support, CIQ formalities, and real-time operational updates.

  3. 03

    Fuel Arrangements at WMPR

    Competitive into-plane pricing, secure fuel releases, and credit arrangements through major oil suppliers and local distributors worldwide. Availability at WMPR is confirmed by the duty dispatcher at the time of request.

  4. 04

    Flight Planning & Dispatch to WMPR

    Optimized routing, weather analysis, NOTAM review, fuel planning, and flight plan filing supported by continuous 24/7 OCC monitoring. Planning reference for WMPR: 5° 45′ 53″ N 103° 0′ 18″ E; elevation 36 ft.

  5. 05

    Crew & Passenger Services in Redang

    Ground transportation, hotel reservations, visa assistance, and expedited meet & greet for crews operating into Redang. Complete passenger handling coordination covering check-in, boarding, special assistance, and CIQ formalities at WMPR.

  6. 06

    Cargo Operations at WMPR

    Support for freighter operations into WMPR covering ULD logistics, ramp and slot coordination, dangerous goods coordination, and rapid turnarounds.

Location

Where WMPR sits in the network

Open in map

Nearest airports in our network

NESWWMKNWMGKWMKCVTSCWMKDWMKIWMPR

Operating into WMPR?

Our 24/7 OCC arranges permits, ground handling, fuel and crew support at Pulau Redang — one desk for the whole trip.

Request flight supportExplore our services