General aviation · Marks Point, Australia

Lake Macquarie

YLMQBEO
Elevation
5 ft
Coordinates
33°04′S 151°39′E
Local time
Australia/Sydney

Photo: U.S. Department of Defense · Public domain · Wikimedia Commons

Field information

YLMQ runways, fuel & airport data

Reference data compiled from public aeronautical sources. Our OCC confirms the operational details for your flight before dispatch.

Lake Macquarie (YLMQ/BEO) has one runway, 07/25, 2,204 ft (672 m) long. Our OCC arranges ground handling, landing permits and fuel at YLMQ, and confirms every figure on this page with the airport and handler before dispatch.

  • Classification

    General aviation

  • Time zone

    Australia/Sydney

  • Country

    Australia

    AU

  • Municipality

    City of Lake Macquarie

  • Elevation

    5 ft

  • Position

    -33.0660, 151.6463

Runways · YLMQ

RunwayLengthWidthSurfaceLighting
07/252,204 ft (672 m)———

Flight support

Ground handling, permits & fuel at YLMQ.

The Network Plan coordinates flight support at Lake Macquarie (YLMQ / BEO) in Marks Point, Australia, through one 24/7 OCC desk. YLMQ is listed in our network as a general aviation. Before dispatch, our OCC verifies permit lead times, slot availability, and local handler capabilities.

Services coordinated at YLMQ

  1. 01

    Overflight & Landing Permits – Australia

    Efficient coordination of overflight, landing, ad hoc, and seasonal block permit applications with the civil aviation authority of Australia. Applicable permit lead times for Australia are confirmed by the duty dispatcher at the time of request. For airline operators, navigation fee verifications, overflight charge audits, and CAA account reconciliations for Australia are managed end-to-end.

  2. 02

    Ground Handling at YLMQ

    Direct FBO and handler coordination at YLMQ covering ramp parking, towing, GPU/ACU support, CIQ formalities, and real-time operational updates.

  3. 03

    Fuel Arrangements at YLMQ

    Competitive into-plane pricing, secure fuel releases, and credit arrangements through major oil suppliers and local distributors worldwide. Availability at YLMQ is confirmed by the duty dispatcher at the time of request.

  4. 04

    Flight Planning & Dispatch to YLMQ

    Optimized routing, weather analysis, NOTAM review, fuel planning, and flight plan filing supported by continuous 24/7 OCC monitoring. Planning reference for YLMQ: 33° 3′ 58″ S 151° 38′ 47″ E; elevation 5 ft.

  5. 05

    Crew & Passenger Services in Marks Point

    Ground transportation, hotel reservations, visa assistance, and expedited meet & greet for crews operating into Marks Point. Complete passenger handling coordination covering check-in, boarding, special assistance, and CIQ formalities at YLMQ.

  6. 06

    Cargo Operations at YLMQ

    Support for freighter operations into YLMQ covering ULD logistics, ramp and slot coordination, dangerous goods coordination, and rapid turnarounds.

Location

Where YLMQ sits in the network

Open in map

Nearest airports in our network

NESWYNRHYWVAYWLMYSRIYSSYYSWSYLMQ

Operating into YLMQ?

Our 24/7 OCC arranges permits, ground handling, fuel and crew support at Lake Macquarie — one desk for the whole trip.

Request flight supportExplore our services