Regional airport · Asheville, United States

Asheville Regional

KAVLAVL
Elevation
2,165 ft
Coordinates
35°26′N 82°33′W
Local time
America/New York

Photo: U.S. Department of Defense · Public domain · Wikimedia Commons

Field information

KAVL runways, fuel & airport data

Reference data compiled from public aeronautical sources. Our OCC confirms the operational details for your flight before dispatch.

Asheville Regional (KAVL/AVL) has one runway, 17/35, 8,002 ft (2,439 m) long of asphalt. Fuel on the field: Jet A-1 & Avgas. Rescue and fire-fighting cover is published as ARFF index B. Operating hours: Open 24 hours (H24). Our OCC arranges ground handling, landing permits and fuel at KAVL, and confirms every figure on this page with the airport and handler before dispatch.

  • Classification

    Regional airport

  • Time zone

    America/New York

  • Country

    United States

    US

  • Municipality

    Asheville

  • Elevation

    2,165 ft

  • Position

    35.4355, -82.5419

  • Traffic level

    High

  • Fuel

    Jet A-1 & Avgas

  • Fire & rescue

    ARFF index B

  • Operating hours

    Open 24 hours (H24)

Runways · KAVL

RunwayLengthWidthSurfaceLighting
17/358,002 ft (2,439 m)150 ftasphaltLighted

Flight support

Ground handling, permits & fuel at KAVL.

The Network Plan coordinates flight support at Asheville Regional (KAVL / AVL) in Asheville, United States of America, through one 24/7 OCC desk. KAVL is listed in our network as a regional airport. Before dispatch, our OCC verifies permit lead times, slot availability, and local handler capabilities.

Services coordinated at KAVL

  1. 01

    Overflight & Landing Permits – United States of America

    Efficient coordination of overflight, landing, ad hoc, and seasonal block permit applications with the civil aviation authority of United States of America. Applicable permit lead times for United States of America are confirmed by the duty dispatcher at the time of request. For airline operators, navigation fee verifications, overflight charge audits, and CAA account reconciliations for United States of America are managed end-to-end.

  2. 02

    Ground Handling at KAVL

    Direct FBO and handler coordination at KAVL covering ramp parking, towing, GPU/ACU support, CIQ formalities, and real-time operational updates.

  3. 03

    Fuel Arrangements at KAVL

    Competitive into-plane pricing, secure fuel releases, and credit arrangements through major oil suppliers and local distributors worldwide. Availability at KAVL is confirmed by the duty dispatcher at the time of request.

  4. 04

    Flight Planning & Dispatch to KAVL

    Optimized routing, weather analysis, NOTAM review, fuel planning, and flight plan filing supported by continuous 24/7 OCC monitoring. Planning reference for KAVL: 35° 26′ 8″ N 82° 32′ 31″ W; elevation 2165 ft.

  5. 05

    Crew & Passenger Services in Asheville

    Ground transportation, hotel reservations, visa assistance, and expedited meet & greet for crews operating into Asheville. Complete passenger handling coordination covering check-in, boarding, special assistance, and CIQ formalities at KAVL.

  6. 06

    Cargo Operations at KAVL

    Support for freighter operations into KAVL covering ULD logistics, ramp and slot coordination, dangerous goods coordination, and rapid turnarounds.

Location

Where KAVL sits in the network

Open in mapRead on Wikipedia

Nearest airports in our network

NESWKGSPKGYHKHKYKTYSKCLTKGVLKAVL

Operating into KAVL?

Our 24/7 OCC arranges permits, ground handling, fuel and crew support at Asheville Regional — one desk for the whole trip.

Request flight supportExplore our services