Regional airport · Greer, United States

Greenville Spartanburg International

KGSPGSP
Elevation
964 ft
Coordinates
34°54′N 82°13′W
Local time
America/New York

Photo: U.S. Department of Defense · Public domain · Wikimedia Commons

Field information

KGSP runways, fuel & airport data

Reference data compiled from public aeronautical sources. Our OCC confirms the operational details for your flight before dispatch.

Greenville Spartanburg International (KGSP/GSP) has one runway, 04/22, 11,001 ft (3,353 m) long of asphalt/concrete. Fuel on the field: Jet A-1 & Avgas. Rescue and fire-fighting cover is published as ARFF index C. Operating hours: Open 24 hours (H24). Our OCC arranges ground handling, landing permits and fuel at KGSP, and confirms every figure on this page with the airport and handler before dispatch.

  • Classification

    Regional airport

  • Time zone

    America/New York

  • Country

    United States

    US

  • Municipality

    Greenville/Greer/Spartanburg

  • Elevation

    964 ft

  • Position

    34.8957, -82.2189

  • Traffic level

    High

  • Fuel

    Jet A-1 & Avgas

  • Fire & rescue

    ARFF index C

  • Operating hours

    Open 24 hours (H24)

Runways · KGSP

RunwayLengthWidthSurfaceLighting
04/2211,001 ft (3,353 m)150 ftasphalt/concreteLighted

Flight support

Ground handling, permits & fuel at KGSP.

The Network Plan coordinates flight support at Greenville Spartanburg International (KGSP / GSP) in Greer, United States of America, through one 24/7 OCC desk. KGSP is listed in our network as a regional airport. Before dispatch, our OCC verifies permit lead times, slot availability, and local handler capabilities.

Services coordinated at KGSP

  1. 01

    Overflight & Landing Permits – United States of America

    Efficient coordination of overflight, landing, ad hoc, and seasonal block permit applications with the civil aviation authority of United States of America. Applicable permit lead times for United States of America are confirmed by the duty dispatcher at the time of request. For airline operators, navigation fee verifications, overflight charge audits, and CAA account reconciliations for United States of America are managed end-to-end.

  2. 02

    Ground Handling at KGSP

    Direct FBO and handler coordination at KGSP covering ramp parking, towing, GPU/ACU support, CIQ formalities, and real-time operational updates.

  3. 03

    Fuel Arrangements at KGSP

    Competitive into-plane pricing, secure fuel releases, and credit arrangements through major oil suppliers and local distributors worldwide. Availability at KGSP is confirmed by the duty dispatcher at the time of request.

  4. 04

    Flight Planning & Dispatch to KGSP

    Optimized routing, weather analysis, NOTAM review, fuel planning, and flight plan filing supported by continuous 24/7 OCC monitoring. Planning reference for KGSP: 34° 53′ 45″ N 82° 13′ 8″ W; elevation 964 ft.

  5. 05

    Crew & Passenger Services in Greer

    Ground transportation, hotel reservations, visa assistance, and expedited meet & greet for crews operating into Greer. Complete passenger handling coordination covering check-in, boarding, special assistance, and CIQ formalities at KGSP.

  6. 06

    Cargo Operations at KGSP

    Support for freighter operations into KGSP covering ULD logistics, ramp and slot coordination, dangerous goods coordination, and rapid turnarounds.

Location

Where KGSP sits in the network

Open in mapRead on Wikipedia

Nearest airports in our network

NESWKGYHKAVLKHKYKCLTKCAEKGVLKGSP

Operating into KGSP?

Our 24/7 OCC arranges permits, ground handling, fuel and crew support at Greenville Spartanburg International — one desk for the whole trip.

Request flight supportExplore our services