Regional airport · Tumaco, Colombia

Tumaco/La Florida

SKCOTCO
Elevation
8 ft
Coordinates
1°49′N 78°45′W
Local time
America/Bogota

Photo: U.S. Department of Defense · Public domain · Wikimedia Commons

Field information

SKCO runways, fuel & airport data

Reference data compiled from public aeronautical sources. Our OCC confirms the operational details for your flight before dispatch.

Tumaco/La Florida (SKCO/TCO) has one runway, 06/24, 5,249 ft (1,600 m) long of asphalt. Fuel on the field: Jet A-1. Rescue and fire-fighting cover is published as RFFS category 4. Operating hours: 1200-2359Z. Our OCC arranges ground handling, landing permits and fuel at SKCO, and confirms every figure on this page with the airport and handler before dispatch.

  • Classification

    Regional airport

  • Time zone

    America/Bogota

  • Country

    Colombia

    CO

  • Municipality

    Tumaco

  • Elevation

    8 ft

  • Position

    1.8144, -78.7492

  • Traffic level

    Medium

  • Fuel

    Jet A-1

  • Fire & rescue

    RFFS category 4

  • Operating hours

    1200-2359Z

Runways · SKCO

RunwayLengthWidthSurfaceLighting
06/245,249 ft (1,600 m)90 ftasphalt—

Flight support

Ground handling, permits & fuel at SKCO.

The Network Plan coordinates flight support at Tumaco/La Florida (SKCO / TCO) in Tumaco, Colombia, through one 24/7 OCC desk. SKCO is listed in our network as a regional airport. Before dispatch, our OCC verifies permit lead times, slot availability, and local handler capabilities.

Services coordinated at SKCO

  1. 01

    Overflight & Landing Permits – Colombia

    Efficient coordination of overflight, landing, ad hoc, and seasonal block permit applications with the civil aviation authority of Colombia. Applicable permit lead times for Colombia are confirmed by the duty dispatcher at the time of request. For airline operators, navigation fee verifications, overflight charge audits, and CAA account reconciliations for Colombia are managed end-to-end.

  2. 02

    Ground Handling at SKCO

    Direct FBO and handler coordination at SKCO covering ramp parking, towing, GPU/ACU support, CIQ formalities, and real-time operational updates.

  3. 03

    Fuel Arrangements at SKCO

    Competitive into-plane pricing, secure fuel releases, and credit arrangements through major oil suppliers and local distributors worldwide. Availability at SKCO is confirmed by the duty dispatcher at the time of request.

  4. 04

    Flight Planning & Dispatch to SKCO

    Optimized routing, weather analysis, NOTAM review, fuel planning, and flight plan filing supported by continuous 24/7 OCC monitoring. Planning reference for SKCO: 1° 48′ 52″ N 78° 44′ 57″ W; elevation 8 ft.

  5. 05

    Crew & Passenger Services in Tumaco

    Ground transportation, hotel reservations, visa assistance, and expedited meet & greet for crews operating into Tumaco. Complete passenger handling coordination covering check-in, boarding, special assistance, and CIQ formalities at SKCO.

  6. 06

    Cargo Operations at SKCO

    Support for freighter operations into SKCO covering ULD logistics, ramp and slot coordination, dangerous goods coordination, and rapid turnarounds.

Location

Where SKCO sits in the network

Open in mapRead on Wikipedia

Nearest airports in our network

NESWSKEHSETNSKIPSKPSSEQMSKPPSKCO

Operating into SKCO?

Our 24/7 OCC arranges permits, ground handling, fuel and crew support at Tumaco/La Florida — one desk for the whole trip.

Request flight supportExplore our services