General aviation · Pilot Point, United States

Pilot Point

PAPNPIP
Elevation
57 ft
Coordinates
57°35′N 157°34′W
Local time
America/Anchorage

Photo: U.S. Department of Defense · Public domain · Wikimedia Commons

Field information

PAPN runways, fuel & airport data

Reference data compiled from public aeronautical sources. Our OCC confirms the operational details for your flight before dispatch.

Pilot Point (PAPN/PIP) has one runway, 07/25, 3,280 ft (1,000 m) long of gravel. Operating hours: Unattended. Our OCC arranges ground handling, landing permits and fuel at PAPN, and confirms every figure on this page with the airport and handler before dispatch.

  • Classification

    General aviation

  • Time zone

    America/Anchorage

  • Country

    United States

    US

  • Municipality

    Pilot Point

  • Elevation

    57 ft

  • Position

    57.5804, -157.5720

  • Operating hours

    Unattended

Runways · PAPN

RunwayLengthWidthSurfaceLighting
07/253,280 ft (1,000 m)75 ftgravel—

Flight support

Ground handling, permits & fuel at PAPN.

The Network Plan coordinates flight support at Pilot Point (PAPN / PIP) in Pilot Point, United States of America, through one 24/7 OCC desk. PAPN is listed in our network as a general aviation. Before dispatch, our OCC verifies permit lead times, slot availability, and local handler capabilities.

Services coordinated at PAPN

  1. 01

    Overflight & Landing Permits – United States of America

    Efficient coordination of overflight, landing, ad hoc, and seasonal block permit applications with the civil aviation authority of United States of America. Applicable permit lead times for United States of America are confirmed by the duty dispatcher at the time of request. For airline operators, navigation fee verifications, overflight charge audits, and CAA account reconciliations for United States of America are managed end-to-end.

  2. 02

    Ground Handling at PAPN

    Direct FBO and handler coordination at PAPN covering ramp parking, towing, GPU/ACU support, CIQ formalities, and real-time operational updates.

  3. 03

    Fuel Arrangements at PAPN

    Competitive into-plane pricing, secure fuel releases, and credit arrangements through major oil suppliers and local distributors worldwide. Availability at PAPN is confirmed by the duty dispatcher at the time of request.

  4. 04

    Flight Planning & Dispatch to PAPN

    Optimized routing, weather analysis, NOTAM review, fuel planning, and flight plan filing supported by continuous 24/7 OCC monitoring. Planning reference for PAPN: 57° 34′ 49″ N 157° 34′ 19″ W; elevation 57 ft.

  5. 05

    Crew & Passenger Services in Pilot Point

    Ground transportation, hotel reservations, visa assistance, and expedited meet & greet for crews operating into Pilot Point. Complete passenger handling coordination covering check-in, boarding, special assistance, and CIQ formalities at PAPN.

  6. 06

    Cargo Operations at PAPN

    Support for freighter operations into PAPN covering ULD logistics, ramp and slot coordination, dangerous goods coordination, and rapid turnarounds.

Location

Where PAPN sits in the network

Open in map

Nearest airports in our network

NESWPAPHPFWSPAKNPFCLPADLPAKYPAPN

Operating into PAPN?

Our 24/7 OCC arranges permits, ground handling, fuel and crew support at Pilot Point — one desk for the whole trip.

Request flight supportExplore our services